Description
95% Min Purity FOXO4 DRI Peptide Powders Vials Packaging
Description
| Name: | FOXO4-DRI | CAS No.: | N/A |
|---|---|---|---|
| Storage: | -9°C | Appearance: | Powder |
| MOQ: | 50mg | Shelf Life: | 1 Year. |
| Purity: | 95% Min | ||
| High Light: |
50mg 95% FOXO4 DRI Peptide, Peptide Powders Vials Packaging, 95% Min Purity Peptide Powders |
||
FOXO4 D-Retro-Inverso peptide 95% FOXO4-DRI 98% Senolytics raw powder and lyophilized powder in vials
supply both raw powder and lyophilized powder in vials.
Lead time of raw powder is 1 week after paid, lyophilized powder need to wait for 2 weeks after paid.
Sequence: H-D-Leu-D-Thr-D-Leu-D-Arg-D-Lys-D-Glu-D-Pro-D-Ala-D-Ser-D-Glu-D-Ile-D-Ala-D-Gln-D-Ser-D-Ile-D-Leu-D-Glu-D-Ala-D-Tyr-D-Ser-D-Gln-D-Asn-D-Gly-D-Trp-D-Ala-D-Asn-D-Arg-D-Arg-D-Ser-D-Gly-D-Gly-D-Lys-D-Arg-D-Pro-D-Pro-D-Pro-D-Arg-D-Arg-D-Arg-D-Gln-D-Arg-D-Arg-D-Lys-D-Lys-D-Arg-D-Gly-OH
Storage
FOXO4 D-Retro-Inverso(DRI) should be stored in a freezer at or below -9C.
After reconstitution, FOXO4 D-Retro-Inverso(DRI) peptide should be kept refrigerated.
Product introduction
Foxo4-dri, FOXO4 D-Retro-Inverso peptide, also known as Proxofim, was first reported in ‘Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging’ by Baar et al.
FOXO4 DRI peptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.












